PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000169485
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 575aa    MW: 64844.8 Da    PI: 4.5207
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000169485genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.91.4e-51181442128
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                    +pGfrFhPtdeelv +yLk+k+ +k+l++ +vi+e+d+yk++P +Lp+   +k+++++w+fFs+rd+ky++g r++rat++gyWkatgkd+++++ 
  MDP0000169485  18 APGFRFHPTDEELVLYYLKRKICKKRLKI-DVIAETDVYKWDPDELPElsLLKTGDRQWFFFSPRDRKYPNGGRSSRATRHGYWKATGKDRTIVC- 111
                    69***************************.99**************9445788899***************************************. PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ vglkktLv+ykgrap+ge+tdWvmhey+l
  MDP0000169485 112 YSRSVGLKKTLVYYKGRAPSGERTDWVMHEYTL 144
                    9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-5813167IPR003441NAC domain
PROSITE profilePS5100553.75117167IPR003441NAC domain
PfamPF023656.9E-2719144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MVTEDDSAAL FCDGHFAAPG FRFHPTDEEL VLYYLKRKIC KKRLKIDVIA ETDVYKWDPD  60
ELPELSLLKT GDRQWFFFSP RDRKYPNGGR SSRATRHGYW KATGKDRTIV CYSRSVGLKK  120
TLVYYKGRAP SGERTDWVMH EYTLDEEELK RCQNVQQYYA LYKVYKKSGP GPKNGEQYGA  180
PFREEDWVDD ESTVIKSAAD HQISVKQAVD VVSIDNVKVN GDVHYALNDI EEFMKQIADE  240
AVLPEMNGYG YTAPQVLSEE DTQSTLVDLY SREVICAEPV REFNPNVQQR NVDANFDFTQ  300
SSASQMQSYE ASEVTTAAPD IYDQDPPALH EEDFLEMDDL LGPEPTVPNT VNPVDDLQFG  360
ELDGLSEFDF YHDAAMFLHD LGPIDEGNVA HHQYMNSQGN NIVDQFEYHL QPNPVAENQV  420
NHLLNPESTQ INNQMWTNTE RAEPNQGSLS YSTPGVVYES SNFPSQATQN QSGNEAAGAT  480
SQFSSALWAF VESIPTTPAS ASENALVNRA FERMSSFSRL RINTASTTVA AGNDSETRRA  540
GRKRGFFFLP VLVALCAVFW VLIATLRPWG RSLST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-481914417140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13544KRKICKKRLK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.150560.0bud| fruit| leaf| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008381037.10.0PREDICTED: uncharacterized protein LOC103443912
SwissprotQ9XIC51e-171NAC17_ARATH; NAC domain-containing protein 17
TrEMBLM5W6F50.0M5W6F5_PRUPE; Uncharacterized protein
STRINGPOPTR_0002s06210.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-160NAC domain containing protein 17